Web Analysis for Primetimeappliancerepairservicesfek - primetimeappliancerepairservicesfek.online
Professional appliance repair services for refrigerators, dishwashers, washers, dryers, ovens, ranges, and microwaves. Same-day service available.
2.50
Rating by CuteStat
primetimeappliancerepairservicesfek.online is 1 month 2 weeks old. It is a domain having online extension. This website is estimated worth of $ 8.94 and have a daily income of around $ 0.15. As no active threats were reported recently by users, primetimeappliancerepairservicesfek.online is SAFE to browse.
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.94 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | 5 |
H3 Headings: | Not Applicable | H4 Headings: | 8 |
H5 Headings: | Not Applicable | H6 Headings: | 1 |
Total IFRAMEs: | 1 | Total Images: | 11 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 66.29.132.68)
HTTP Header Analysis
HTTP/1.1 200 OK
keep-alive: timeout=5, max=100
content-type: text/html
last-modified: Tue, 23 Apr 2024 03:24:16 GMT
accept-ranges: bytes
content-encoding: br
vary: Accept-Encoding
content-length: 5250
date: Tue, 23 Apr 2024 22:12:05 GMT
server: LiteSpeed
x-turbo-charged-by: LiteSpeed
keep-alive: timeout=5, max=100
content-type: text/html
last-modified: Tue, 23 Apr 2024 03:24:16 GMT
accept-ranges: bytes
content-encoding: br
vary: Accept-Encoding
content-length: 5250
date: Tue, 23 Apr 2024 22:12:05 GMT
server: LiteSpeed
x-turbo-charged-by: LiteSpeed
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
dns1.namecheaphosting.com | 156.154.132.200 | United States of America | |
dns2.namecheaphosting.com | 156.154.133.200 | United States of America |
Full WHOIS Lookup
Domain name: primetimeappliancerepairservicesfek.online
Registry Domain ID: D448995492-CNIC
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 0001-01-01T00:00:00.00Z
Creation Date: 2024-04-23T00:50:28.00Z
Registrar Registration Expiration Date: 2025-04-23T00:50:28.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.9854014545
Reseller: NAMECHEAP INC
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registry Registrant ID:
Registrant Name: Redacted for Privacy
Registrant Organization: Privacy service provided by Withheld for Privacy ehf
Registrant Street: Kalkofnsvegur 2
Registrant City: Reykjavik
Registrant State/Province: Capital Region
Registrant Postal Code: 101
Registrant Country: IS
Registrant Phone: +354.4212434
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: 9ba5236fea404357a6599096e805dbeb.protect@withheldforprivacy.com
Registry Admin ID:
Admin Name: Redacted for Privacy
Admin Organization: Privacy service provided by Withheld for Privacy ehf
Admin Street: Kalkofnsvegur 2
Admin City: Reykjavik
Admin State/Province: Capital Region
Admin Postal Code: 101
Admin Country: IS
Admin Phone: +354.4212434
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: 9ba5236fea404357a6599096e805dbeb.protect@withheldforprivacy.com
Registry Tech ID:
Tech Name: Redacted for Privacy
Tech Organization: Privacy service provided by Withheld for Privacy ehf
Tech Street: Kalkofnsvegur 2
Tech City: Reykjavik
Tech State/Province: Capital Region
Tech Postal Code: 101
Tech Country: IS
Tech Phone: +354.4212434
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: 9ba5236fea404357a6599096e805dbeb.protect@withheldforprivacy.com
Name Server: dns1.namecheaphosting.com
Name Server: dns2.namecheaphosting.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2024-04-23T09:12:07.05Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
Registry Domain ID: D448995492-CNIC
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 0001-01-01T00:00:00.00Z
Creation Date: 2024-04-23T00:50:28.00Z
Registrar Registration Expiration Date: 2025-04-23T00:50:28.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.9854014545
Reseller: NAMECHEAP INC
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registry Registrant ID:
Registrant Name: Redacted for Privacy
Registrant Organization: Privacy service provided by Withheld for Privacy ehf
Registrant Street: Kalkofnsvegur 2
Registrant City: Reykjavik
Registrant State/Province: Capital Region
Registrant Postal Code: 101
Registrant Country: IS
Registrant Phone: +354.4212434
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: 9ba5236fea404357a6599096e805dbeb.protect@withheldforprivacy.com
Registry Admin ID:
Admin Name: Redacted for Privacy
Admin Organization: Privacy service provided by Withheld for Privacy ehf
Admin Street: Kalkofnsvegur 2
Admin City: Reykjavik
Admin State/Province: Capital Region
Admin Postal Code: 101
Admin Country: IS
Admin Phone: +354.4212434
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: 9ba5236fea404357a6599096e805dbeb.protect@withheldforprivacy.com
Registry Tech ID:
Tech Name: Redacted for Privacy
Tech Organization: Privacy service provided by Withheld for Privacy ehf
Tech Street: Kalkofnsvegur 2
Tech City: Reykjavik
Tech State/Province: Capital Region
Tech Postal Code: 101
Tech Country: IS
Tech Phone: +354.4212434
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: 9ba5236fea404357a6599096e805dbeb.protect@withheldforprivacy.com
Name Server: dns1.namecheaphosting.com
Name Server: dns2.namecheaphosting.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2024-04-23T09:12:07.05Z <<<
For more information on Whois status codes, please visit https://icann.org/epp